Westlakevillagefamilyservices.com
Visit westlakevillagefamilyservices.comWestlake Village Thousand Oaks individual couple family group therapy
Global rank | - |
---|---|
Daily visitors | - |
Daily pageviews | - |
Pageviews per user | 0 |
Rating | |
---|---|
Status | Online |
Latest check |
Countable Data Brief
Westlakevillagefamilyservices.com is tracked by us since November, 2019. Over the time it has been ranked as high as 8 513 999 in the world. It was hosted by Internet Brands Inc. and CloudFlare Inc..
Westlakevillagefamilyservices has the lowest Google pagerank and bad results in terms of Yandex topical citation index. We found that Westlakevillagefamilyservices.com is poorly ‘socialized’ in respect to any social network. According to Google safe browsing analytics, Westlakevillagefamilyservices.com is quite a safe domain with no visitor reviews.
Worldwide Audience
Compare it to ...It seems that traffic on this site is too low to be displayed, sorry.
Traffic Analysis
Compare it to ...It seems that the number of visitors and pageviews on this site is too low to be displayed, sorry.
Subdomains Traffic Shares
Westlakevillagefamilyservices.com has no subdomains with considerable traffic.
SEO Stats
Compare it to ...Westlakevillagefamilyservices.com is not yet effective in its SEO tactics: it has Google PR 0. It may also be penalized or lacking valuable inbound links.
0
Google PR-
Yandex CYMetadata Updates Get more Westlakevillagefamilyservices.com metadata updates
Homepage Top Backlinks PR
No data
Top Keywords % of search traffic
village family services | 23.38% |
Domain Registration Data
Compare it to ...Westlakevillagefamilyservices.com domain is owned by Registration Private Domains By Proxy, LLC and its registration expires in 7 months.
General Get more Westlakevillagefamilyservices.com whois history
Registration Private Domains By Proxy, LLC Owner since November 28, 2019 |
||
---|---|---|
7 months left Expires on May 28, 2025 |
15 years old Created on March 29, 2009 |
1 year ago Changed at May 28, 2023 |
Registrar and Status
Registar | GODADDY.COM, LLC |
Status |
clientDeleteProhibited clientRenewProhibited clientTransferProhibited clientUpdateProhibited |
In Other TLDs
No data
Similar Domain Names
Server Information
Compare it to ...Westlakevillagefamilyservices.com is hosted by CloudFlare, Inc.
IP Whois Get more Westlakevillagefamilyservices.com server history
-
CloudFlare, Inc.
-
104.21.14.192
IP address
Server Technologies
No data
DNS Records
Nameservers
- lola.ns.cloudflare.com
- skip.ns.cloudflare.com
host | value | ttl |
---|---|---|
westlakevillagefamilyservices.com | 104.21.14.192 |
291 |
westlakevillagefamilyservices.com | 172.67.160.45 |
291 |
host | value | ttl |
---|---|---|
westlakevillagefamilyservices.com | 300 | |
westlakevillagefamilyservices.com | 300 |
host | value | ttl | pri |
---|---|---|---|
westlakevillagefamilyservices.com | mx.westlakevillagefamilyservices.com.cust.a.hostedemail.com |
300 | 0 |
host | value | ttl |
---|---|---|
westlakevillagefamilyservices.com | lola.ns.cloudflare.com |
300 |
westlakevillagefamilyservices.com | skip.ns.cloudflare.com |
300 |
host | value | ttl |
---|---|---|
westlakevillagefamilyservices.com | Mname: lola.ns.cloudflare.com |
300 |
host | value | ttl |
---|---|---|
westlakevillagefamilyservices.com | Txt: v=spf1 a mx include:_spf.hostedemail.com ip4:216.40.44.0/24 ip4:216.40.42.0/24 ~all |
300 |
Safety
Compare it to ...Safety status of Westlakevillagefamilyservices.com is described as follows: Google Safe Browsing reports its status as safe.
MyWOT
Overall reputation | Unknown |
---|---|
Trustworthiness | Unknown |
Privacy | Unknown |
Child safety | Unknown |
Google Safe Browsing
Website status | Safe |
---|---|
Status | ok |
User reviews
Reputation | Unknown | |
---|---|---|
0 positive0 negative |
Social Engagement
Compare it to ...It seems Westlakevillagefamilyservices.com has no mentions in social networks.