Tanganyikawildernesscamps.resrequest.com

Visit tanganyikawildernesscamps.resrequest.com
Global rank -
Daily visitors -
Daily pageviews -
Pageviews per user 0
Rating
Status Online
Latest check

Countable Data Brief

Resrequest.com is tracked by us since April, 2011. Over the time it has been ranked as high as 89 799 in the world, while most of its traffic comes from USA, where it reached as high as 136 244 position. Tanganyikawildernesscamps.resrequest.com receives less than 1% of its total traffic. It was owned by several entities, from Workflow Solutions (Pty) Ltd House 22 to REDACTED FOR PRIVACY of Privacy service provided by Withheld for Privacy ehf, it was hosted by C0201199905 and xneelo-tscolo. While TIERRANET INC. D/B/A DOMAINDISCOVER was its first registrar, now it is moved to NameCheap Inc..

Tanganyikawildernesscamps.resrequest has the lowest Google pagerank and bad results in terms of Yandex topical citation index. We found that Tanganyikawildernesscamps.resrequest.com is poorly ‘socialized’ in respect to any social network. According to Google safe browsing analytics, Tanganyikawildernesscamps.resrequest.com is quite a safe domain with no visitor reviews.

Traffic Analysis

Compare it to ...

It seems that the number of visitors and pageviews on this site is too low to be displayed, sorry.

Subdomains Traffic Shares

Tanganyikawildernesscamps.resrequest.com has no subdomains with considerable traffic.

SEO Stats

Compare it to ...

Tanganyikawildernesscamps.resrequest.com is not yet effective in its SEO tactics: it has Google PR 0. It may also be penalized or lacking valuable inbound links.

Ranks

0

Google PR

-

Yandex CY

Top Keywords % of search traffic

No data

Domain Registration Data

Compare it to ...

Tanganyikawildernesscamps.resrequest.com domain is owned by Redacted for Privacy Privacy service provided by Withheld for Privacy ehf and its registration expires in 1 month.

General Get more Resrequest.com whois history

Redacted for Privacy Privacy service provided by Withheld for Privacy ehf

Owner since December 03, 2021

1 month left

Expires on January 07, 2025

21 years old

Created on January 07, 2003

11 months ago

Changed at December 08, 2023

Server Information

Compare it to ...

Tanganyikawildernesscamps.resrequest.com is hosted by xneelo-tscolo.

IP Whois Get more Tanganyikawildernesscamps.resrequest.com server history

  • xneelo-tscolo

  • 129.232.235.234

    IP address

Server Technologies

  • Nginx

    Backend server

DNS Records

Nameservers

No data

host value ttl
tanganyikawildernesscamps.resrequest.com

129.232.235.234

289
host value ttl
tanganyikawildernesscamps.resrequest.com

803.resrequest.net

289

Safety status of Tanganyikawildernesscamps.resrequest.com is described as follows: Google Safe Browsing reports its status as safe.

MyWOT

Overall reputation Unknown
Trustworthiness Unknown
Privacy Unknown
Child safety Unknown

Google Safe Browsing

Website status Safe
Status ok

User reviews

Reputation Unknown

0

negative