Tanganyikawildernesscamps.resrequest.com
Visit tanganyikawildernesscamps.resrequest.comGlobal rank | - |
---|---|
Daily visitors | - |
Daily pageviews | - |
Pageviews per user | 0 |
Rating | |
---|---|
Status | Online |
Latest check |
Countable Data Brief
Resrequest.com is tracked by us since April, 2011. Over the time it has been ranked as high as 89 799 in the world, while most of its traffic comes from USA, where it reached as high as 136 244 position. Tanganyikawildernesscamps.resrequest.com receives less than 1% of its total traffic. It was owned by several entities, from Workflow Solutions (Pty) Ltd House 22 to REDACTED FOR PRIVACY of Privacy service provided by Withheld for Privacy ehf, it was hosted by C0201199905 and xneelo-tscolo. While TIERRANET INC. D/B/A DOMAINDISCOVER was its first registrar, now it is moved to NameCheap Inc..
Tanganyikawildernesscamps.resrequest has the lowest Google pagerank and bad results in terms of Yandex topical citation index. We found that Tanganyikawildernesscamps.resrequest.com is poorly ‘socialized’ in respect to any social network. According to Google safe browsing analytics, Tanganyikawildernesscamps.resrequest.com is quite a safe domain with no visitor reviews.
Worldwide Audience
Compare it to ...Resrequest.com gets 20.7% of its traffic from USA where it is ranked #542175.
Top Countries
USA | 20.7% |
Top Ranks
USA | 542 175 |
Traffic Analysis
Compare it to ...It seems that the number of visitors and pageviews on this site is too low to be displayed, sorry.
Subdomains Traffic Shares
Tanganyikawildernesscamps.resrequest.com has no subdomains with considerable traffic.
SEO Stats
Compare it to ...Tanganyikawildernesscamps.resrequest.com is not yet effective in its SEO tactics: it has Google PR 0. It may also be penalized or lacking valuable inbound links.
0
Google PR-
Yandex CYHomepage Top Backlinks PR
No data
Top Keywords % of search traffic
No data
Domain Registration Data
Compare it to ...Tanganyikawildernesscamps.resrequest.com domain is owned by Redacted for Privacy Privacy service provided by Withheld for Privacy ehf and its registration expires in 1 month.
General Get more Resrequest.com whois history
Redacted for Privacy Privacy service provided by Withheld for Privacy ehf Owner since December 03, 2021 |
||
---|---|---|
1 month left Expires on January 07, 2025 |
21 years old Created on January 07, 2003 |
11 months ago Changed at December 08, 2023 |
Server Information
Compare it to ...Tanganyikawildernesscamps.resrequest.com is hosted by xneelo-tscolo.
IP Whois Get more Tanganyikawildernesscamps.resrequest.com server history
-
xneelo-tscolo
-
129.232.235.234
IP address
Server Technologies
-
Nginx
Backend server
DNS Records
Nameservers
No data
host | value | ttl |
---|---|---|
tanganyikawildernesscamps.resrequest.com | 129.232.235.234 |
289 |
host | value | ttl |
---|---|---|
tanganyikawildernesscamps.resrequest.com | 803.resrequest.net |
289 |
Safety
Compare it to ...Safety status of Tanganyikawildernesscamps.resrequest.com is described as follows: Google Safe Browsing reports its status as safe.
MyWOT
Overall reputation | Unknown |
---|---|
Trustworthiness | Unknown |
Privacy | Unknown |
Child safety | Unknown |
Google Safe Browsing
Website status | Safe |
---|---|
Status | ok |
User reviews
Reputation | Unknown | |
---|---|---|
0 positive0 negative |
Social Engagement
Compare it to ...It seems Tanganyikawildernesscamps.resrequest.com has no mentions in social networks.