Speakenglishwithtiffaniacademy.com
Visit speakenglishwithtiffaniacademy.comLET'S JUMP RIGHT IN! | Speak English With Tiffani Academy
Global rank | - |
---|---|
Daily visitors | 3.47K |
Daily pageviews | 3.47K |
Pageviews per user | 1 |
Rating | |
---|---|
Status | Online |
Latest check |
Countable Data Brief
Speakenglishwithtiffaniacademy.com is tracked by us since August, 2019. Over the time it has been ranked as high as 661 799 in the world. All this time it was owned by REDACTED FOR PRIVACY of Privacy service provided by Withheld for Privacy ehf, it was hosted by CloudFlare Inc..
Speakenglishwithtiffaniacademy has the lowest Google pagerank and bad results in terms of Yandex topical citation index. We found that Speakenglishwithtiffaniacademy.com is poorly ‘socialized’ in respect to any social network. According to Siteadvisor and Google safe browsing analytics, Speakenglishwithtiffaniacademy.com is quite a safe domain with no visitor reviews.
Worldwide Audience
Compare it to ...It seems that traffic on this site is too low to be displayed, sorry.
Traffic Analysis
Compare it to ...Speakenglishwithtiffaniacademy.com has 3.47K visitors and 3.47K pageviews daily.
Pageviews
Subdomains Traffic Shares
Speakenglishwithtiffaniacademy.com has no subdomains with considerable traffic.
SEO Stats
Compare it to ...Speakenglishwithtiffaniacademy.com is not yet effective in its SEO tactics: it has Google PR 0. It may also be penalized or lacking valuable inbound links.
0
Google PR-
Yandex CYMetadata Updates Get more Speakenglishwithtiffaniacademy.com metadata updates
Homepage Top Backlinks PR
speakenglishwithtiffani.com | 0 |
Top Keywords % of search traffic
tiffani | 46.78% |
speak English | 28.69% |
speak english with me | 6.56% |
english expressions pdf | 2.28% |
Domain Registration Data
Compare it to ...Speakenglishwithtiffaniacademy.com domain is owned by Redacted for Privacy Privacy service provided by Withheld for Privacy ehf and its registration expires in 1 year.
General Get more Speakenglishwithtiffaniacademy.com whois history
Redacted for Privacy Privacy service provided by Withheld for Privacy ehf Owner since August 30, 2022 |
||
---|---|---|
1 year ago Expired on December 04, 2022 |
5 years old Created on December 04, 2018 |
2 years ago Changed at November 04, 2021 |
Registrar and Status
Registar | NAMECHEAP, INC. |
Sponsor | NAMECHEAP INC |
Status |
clientTransferProhibited |
In Other TLDs
No data
Similar Domain Names
Server Information
Compare it to ...Speakenglishwithtiffaniacademy.com is hosted by CloudFlare, Inc.
IP Whois Get more Speakenglishwithtiffaniacademy.com server history
-
CloudFlare, Inc.
-
104.21.57.68
IP address
Server Technologies
No data
DNS Records
Nameservers
- dilbert.ns.cloudflare.com
- zara.ns.cloudflare.com
host | value | ttl |
---|---|---|
speakenglishwithtiffaniacademy.com | 104.21.57.68 |
296 |
speakenglishwithtiffaniacademy.com | 172.67.189.99 |
296 |
host | value | ttl |
---|---|---|
speakenglishwithtiffaniacademy.com | 293 | |
speakenglishwithtiffaniacademy.com | 293 |
host | value | ttl | pri |
---|---|---|---|
speakenglishwithtiffaniacademy.com | eforward2.registrar-servers.com |
300 | 10 |
speakenglishwithtiffaniacademy.com | eforward1.registrar-servers.com |
300 | 10 |
speakenglishwithtiffaniacademy.com | eforward3.registrar-servers.com |
300 | 10 |
speakenglishwithtiffaniacademy.com | eforward4.registrar-servers.com |
300 | 15 |
speakenglishwithtiffaniacademy.com | eforward5.registrar-servers.com |
300 | 20 |
host | value | ttl |
---|---|---|
speakenglishwithtiffaniacademy.com | dilbert.ns.cloudflare.com |
86400 |
speakenglishwithtiffaniacademy.com | zara.ns.cloudflare.com |
86400 |
host | value | ttl |
---|---|---|
speakenglishwithtiffaniacademy.com | Mname: dilbert.ns.cloudflare.com |
1800 |
host | value | ttl |
---|---|---|
speakenglishwithtiffaniacademy.com | Txt: v=spf1 include:spf.efwd.registrar-servers.com ~all |
300 |
Safety
Compare it to ...Safety status of Speakenglishwithtiffaniacademy.com is described as follows: Google Safe Browsing reports its status as safe.
MyWOT
Overall reputation | Unknown |
---|---|
Trustworthiness | Unknown |
Privacy | Unknown |
Child safety | Unknown |
Google Safe Browsing
Website status | Safe |
---|---|
Status | ok |
User reviews
Reputation | Unknown | |
---|---|---|
0 positive0 negative |
Social Engagement
Compare it to ...It seems Speakenglishwithtiffaniacademy.com has no mentions in social networks.