Obatbronkitis.web.id
Visit obatbronkitis.web.id| Global rank | - |
|---|---|
| Daily visitors | - |
| Daily pageviews | - |
| Pageviews per user | 0 |
| Rating | |
|---|---|
| Status | Offline |
| Latest check |
Countable Data Brief
Obatbronkitis.web.id is tracked by us since September, 2014. Over the time it has been ranked as high as 13 074 599 in the world, while most of its traffic comes from Indonesia, where it reached as high as 416 193 position. All this time it was owned by Herbalist indonesia of Bunhaw, it was hosted by WEBSITEWELCOME.COM, PT Digital Registra Indonesia and others.
Obatbronkitis has the lowest Google pagerank and bad results in terms of Yandex topical citation index. We found that Obatbronkitis.web.id is poorly ‘socialized’ in respect to any social network. According to Google safe browsing analytics, Obatbronkitis.web.id is quite a safe domain with mostly negative visitor reviews.
Worldwide Audience
Compare it to ...Obatbronkitis.web.id gets 100% of its traffic from Indonesia where it is ranked #416193.
Top Countries
| Indonesia | 100.0% |
Top Ranks
| Indonesia | 416 193 |
Traffic Analysis
Compare it to ...It seems that the number of visitors and pageviews on this site is too low to be displayed, sorry.
Subdomains Traffic Shares
Obatbronkitis.web.id has no subdomains with considerable traffic.
SEO Stats
Compare it to ...Obatbronkitis.web.id is not yet effective in its SEO tactics: it has Google PR 0. It may also be penalized or lacking valuable inbound links.
0
Google PR-
Yandex CYHomepage Top Backlinks PR
| bscisc.blogspot.com | 0 |
| obatalternatifpenyakitjantungkoroner.wordpress.com | 0 |
| obatbengkakdileher.wordpress.com | 0 |
| obatdarahtinggitanpaefeksampingg.wordpress.com | 0 |
| obatgejaladarahtinggino1.wordpress.com | 0 |
Top Keywords % of search traffic
No data
Domain Registration Data
Compare it to ...Obatbronkitis.web.id domain is owned by Herbalist indonesia Bunhaw and its registration expires in 2 years.
General Get more Obatbronkitis.web.id whois history
|
Herbalist indonesia Bunhaw Owner since September 03, 2014 |
||
|---|---|---|
|
2 years ago Expired on August 19, 2022 |
10 years old Created on August 19, 2014 |
3 years ago Changed at August 19, 2021 |
Registrar and Status
| Registar | id.registry |
| Sponsor | Digital Registra |
| Status |
autoRenewPeriod clientTransferProhibited serverTransferProhibited |
In Other TLDs
No data
Similar Domain Names
Server Information
Compare it to ...Obatbronkitis.web.id is hosted by PT Digital Registra Indonesia.
IP Whois Get more Obatbronkitis.web.id server history
-
PT Digital Registra Indonesia
-
103.253.214.7
IP address
Server Technologies
-
Nginx
Backend server
DNS Records
Nameservers
- expire1.mysrsx.com
- expire2.mysrsx.com
| host | value | ttl |
|---|---|---|
| obatbronkitis.web.id | 103.253.214.7 |
0 |
Safety
Compare it to ...Safety status of Obatbronkitis.web.id is described as follows: Google Safe Browsing reports its status as safe, while users provide mostly negative reviews (73%).
Get more Obatbronkitis.web.id reviews
MyWOT
| Overall reputation | Unknown |
|---|---|
| Trustworthiness | Unknown |
| Privacy | Unknown |
| Child safety | Unknown |
Google Safe Browsing
| Website status | Safe |
|---|---|
| Status | ok |
User reviews
| Reputation | Negative | |
|---|---|---|
|
27% positive73% negative |
||
Social Engagement
Compare it to ...Obatbronkitis.web.id has 0% of its total traffic coming from social networks (in last 3 months) and the most active engagement is detected in Facebook (9 shares)
Social Metrics Get more Obatbronkitis.web.id social history
0%
of total traffic in last 3 months is social0
Facebook likes9
Facebook shares3
Twitter mentions0
Google pluses0
LinkedIn mentions0
Pinterest pins0
StumbleUpon views