Kayserievdenevenakliyat.biz
Visit kayserievdenevenakliyat.bizGlobal rank | - |
---|---|
Daily visitors | - |
Daily pageviews | - |
Pageviews per user | 0 |
Rating | |
---|---|
Status | Online |
Latest check |
Countable Data Brief
Kayserievdenevenakliyat.biz is tracked by us since May, 2019. Over the time it has been ranked as high as 8 012 663 in the world. It was owned by several entities, from FBS INC / Whoisprotection.biz to REDACTED FOR PRIVACY of Contact Privacy Inc. Customer 7151571251, it was hosted by Aerotek Bilisim Sanayi ve Ticaret AS., CloudFlare Inc. and others.
Kayserievdenevenakliyat has the lowest Google pagerank and bad results in terms of Yandex topical citation index. We found that Kayserievdenevenakliyat.biz is poorly ‘socialized’ in respect to any social network. According to Siteadvisor and Google safe browsing analytics, Kayserievdenevenakliyat.biz is quite a safe domain with no visitor reviews.
Worldwide Audience
Compare it to ...It seems that traffic on this site is too low to be displayed, sorry.
Traffic Analysis
Compare it to ...It seems that the number of visitors and pageviews on this site is too low to be displayed, sorry.
Subdomains Traffic Shares
Kayserievdenevenakliyat.biz has no subdomains with considerable traffic.
SEO Stats
Compare it to ...Kayserievdenevenakliyat.biz is not yet effective in its SEO tactics: it has Google PR 0. It may also be penalized or lacking valuable inbound links.
0
Google PR-
Yandex CYHomepage Top Backlinks PR
kayserievdenevenakliyatfirmalari.com | 0 |
Top Keywords % of search traffic
sarız evden eve nakliyat | 68.42% |
bünyan evden eve nakliyat | 14.00% |
hacılar evden eve nakliyat | 8.68% |
pınarbaşı evden eve nakliyat | 2.11% |
kayseri evden eve nakliyat melikgazi | 1.92% |
Domain Registration Data
Compare it to ...Kayserievdenevenakliyat.biz domain is owned by REDACTED FOR PRIVACY Contact Privacy Inc. Customer 7151571251 and its registration expires in 6 months.
General Get more Kayserievdenevenakliyat.biz whois history
REDACTED FOR PRIVACY Contact Privacy Inc. Customer 7151571251 Owner since October 08, 2022 |
||
---|---|---|
6 months ago Expired on March 16, 2024 |
10 years old Created on March 16, 2014 |
2 years ago Changed at August 17, 2022 |
Registrar and Status
Status |
clientTransferProhibited |
In Other TLDs
Server Information
Compare it to ...Kayserievdenevenakliyat.biz uses WordPress CMS and is hosted by CloudFlare, Inc.
IP Whois Get more Kayserievdenevenakliyat.biz server history
-
CloudFlare, Inc.
-
104.21.60.8
IP address
Server Technologies
-
WordPress
CMS
DNS Records
Nameservers
- dora.ns.cloudflare.com
- earl.ns.cloudflare.com
host | value | ttl |
---|---|---|
kayserievdenevenakliyat.biz | 104.21.60.8 |
300 |
kayserievdenevenakliyat.biz | 172.67.186.212 |
300 |
host | value | ttl |
---|---|---|
kayserievdenevenakliyat.biz | 300 | |
kayserievdenevenakliyat.biz | 300 |
host | value | ttl | pri |
---|---|---|---|
kayserievdenevenakliyat.biz | ni-magic.guzelhosting.com |
300 | 0 |
host | value | ttl |
---|---|---|
kayserievdenevenakliyat.biz | dora.ns.cloudflare.com |
86400 |
kayserievdenevenakliyat.biz | earl.ns.cloudflare.com |
86400 |
host | value | ttl |
---|---|---|
kayserievdenevenakliyat.biz | Mname: dora.ns.cloudflare.com |
1800 |
Safety
Compare it to ...Safety status of Kayserievdenevenakliyat.biz is described as follows: Google Safe Browsing reports its status as safe.
Get more Kayserievdenevenakliyat.biz reviews
MyWOT
Overall reputation | Unknown |
---|---|
Trustworthiness | Unknown |
Privacy | Unknown |
Child safety | Unknown |
Google Safe Browsing
Website status | Safe |
---|---|
Status | ok |
User reviews
Reputation | Unknown | |
---|---|---|
0 positive0 negative |
Social Engagement
Compare it to ...It seems Kayserievdenevenakliyat.biz has no mentions in social networks.