Kayip-ilani.com
Visit kayip-ilani.comGlobal rank | - |
---|---|
Daily visitors | - |
Daily pageviews | - |
Pageviews per user | 0 |
Rating | |
---|---|
Status | Online |
Latest check |
Countable Data Brief
Kayip-ilani.com is tracked by us since January, 2013. Over the time it has been ranked as high as 549 299 in the world, while most of its traffic comes from Turkey, where it reached as high as 32 309 position. It was owned by several entities, from for information purposes and to assist persons in Mehmet Gokmen to REDACTED FOR PRIVACY of REDACTED FOR PRIVACY, it was hosted by Natro Communication Ltd., Makdos Bilisim Teknolojileri Sanayi Ticaret Limited Sirketi and others. While was its first registrar, now it is moved to Nics Telekomunikasyon A.S..
Kayip-ilani has a mediocre Google pagerank and bad results in terms of Yandex topical citation index. We found that Kayip-ilani.com is poorly ‘socialized’ in respect to any social network. According to Google safe browsing analytics, Kayip-ilani.com is quite a safe domain with no visitor reviews.
Worldwide Audience
Compare it to ...Kayip-ilani.com gets 100% of its traffic from Turkey where it is ranked #32309.
Top Countries
Turkey | 100.0% |
Top Ranks
Turkey | 32 309 |
Traffic Analysis
Compare it to ...It seems that the number of visitors and pageviews on this site is too low to be displayed, sorry.
Subdomains Traffic Shares
Kayip-ilani.com has no subdomains with considerable traffic.
SEO Stats
Compare it to ...Kayip-ilani.com has Google PR 2 and its top keyword is "gazete kayıp ilanı" with 19.47% of search traffic.
2
Google PR-
Yandex CYHomepage Top Backlinks PR
toplist724.tr.gg | 3 |
diplomakayipilani.blogspot.com | 0 |
gazeteilanvermekankara.blogspot.com | 0 |
gecicimezuniyetbelgesikayipilani.blogspot.com | 0 |
ogrencikimligikayipilanivermek.blogspot.com | 0 |
Top Keywords % of search traffic
gazete kayıp ilanı | 19.47% |
kayıp ilanı ver | 8.32% |
kayıp ilanları | |
kayip ilani | |
ilan |
Domain Registration Data
Compare it to ...Kayip-ilani.com domain is owned by Redacted for privacy and its registration expires in 5 months.
General Get more Kayip-ilani.com whois history
Redacted for privacy Owner since December 24, 2023 |
||
---|---|---|
5 months ago Expired on May 06, 2024 |
12 years old Created on May 06, 2012 |
1 year ago Changed at May 09, 2023 |
Registrar and Status
Registar | Nics Telekomunikasyon A.S. |
Sponsor | CIZGI TELEKOMUNIKASYON A.S - NATRO |
Status |
ok |
In Other TLDs
Similar Domain Names
- 1. kayip-ilan.com
- 2. kayipfikir.com
- 3. kayipbulucu.com
- 4. kayiphayvan.com
- 5. kayiphayvanlar.com
Server Information
Compare it to ...Kayip-ilani.com uses WordPress CMS and is hosted by Makdos Bilisim Teknolojileri Sanayi Ticaret Limited Sirketi.
IP Whois Get more Kayip-ilani.com server history
-
Makdos Bilisim Teknolojileri Sanayi Ticaret Limited Sirketi
-
185.122.203.95
IP address
Server Technologies
-
Nginx
Backend server -
WordPress
CMS
DNS Records
Nameservers
- ns1.kayip-ilani.com
- ns2.kayip-ilani.com
host | value | ttl |
---|---|---|
kayip-ilani.com | 185.122.203.95 |
300 |
host | value | ttl |
---|---|---|
kayip-ilani.com | 600 |
host | value | ttl | pri |
---|---|---|---|
kayip-ilani.com | mail.kayip-ilani.com |
600 | 10 |
host | value | ttl |
---|---|---|
kayip-ilani.com | ns2.kayip-ilani.com |
86400 |
kayip-ilani.com | ns1.kayip-ilani.com |
86400 |
host | value | ttl |
---|---|---|
kayip-ilani.com | Mname: ns1.kayip-ilani.com.kayip-ilani.com |
86400 |
Safety
Compare it to ...Safety status of Kayip-ilani.com is described as follows: Google Safe Browsing reports its status as safe.
Get more Kayip-ilani.com reviews
MyWOT
Overall reputation | Unknown |
---|---|
Trustworthiness | Unknown |
Privacy | Unknown |
Child safety | Unknown |
Google Safe Browsing
Website status | Safe |
---|---|
Status | ok |
User reviews
Reputation | Unknown | |
---|---|---|
0 positive0 negative |
Social Engagement
Compare it to ...Kayip-ilani.com has 0% of its total traffic coming from social networks (in last 3 months) and the most active engagement is detected in Facebook (94 shares)
Social Metrics Get more Kayip-ilani.com social history
0%
of total traffic in last 3 months is social0
Facebook likes94
Facebook shares21
Twitter mentions15
Google pluses4
LinkedIn mentions0
Pinterest pins0
StumbleUpon views