Kathrynleesmithwhitelineprints.com
Visit kathrynleesmithwhitelineprints.comKathryn Lee Smith, white-line woodblock Provincetown print artist. Welcome!
Global rank | - |
---|---|
Daily visitors | - |
Daily pageviews | - |
Pageviews per user | 0 |
Rating | |
---|---|
Status | Online |
Latest check |
Countable Data Brief
Kathrynleesmithwhitelineprints.com is tracked by us since February, 2021. All this time it was owned by Smith Kathryn, it was hosted by Network Solutions LLC and MonsterCommerce LLC.
Kathrynleesmithwhitelineprints has the lowest Google pagerank and bad results in terms of Yandex topical citation index. We found that Kathrynleesmithwhitelineprints.com is poorly ‘socialized’ in respect to any social network. According to Google safe browsing analytics, Kathrynleesmithwhitelineprints.com is quite a safe domain with no visitor reviews.
Worldwide Audience
Compare it to ...It seems that traffic on this site is too low to be displayed, sorry.
Traffic Analysis
Compare it to ...It seems that the number of visitors and pageviews on this site is too low to be displayed, sorry.
Subdomains Traffic Shares
Kathrynleesmithwhitelineprints.com has no subdomains with considerable traffic.
SEO Stats
Compare it to ...Kathrynleesmithwhitelineprints.com is not yet effective in its SEO tactics: it has Google PR 0. It may also be penalized or lacking valuable inbound links.
0
Google PR-
Yandex CYMetadata Updates Get more Kathrynleesmithwhitelineprints.com metadata updates
Homepage Top Backlinks PR
No data
Top Keywords % of search traffic
No data
Domain Registration Data
Compare it to ...Kathrynleesmithwhitelineprints.com domain is owned by Smith, Kathryn and its registration expires in 7 months.
General Get more Kathrynleesmithwhitelineprints.com whois history
Smith, Kathryn Owner since February 20, 2022 |
||
---|---|---|
7 months ago Expired on February 04, 2024 |
15 years old Created on February 04, 2009 |
1 year ago Changed at January 28, 2023 |
Registrar and Status
Registar | Network Solutions, LLC |
Status |
clientTransferProhibited |
In Other TLDs
No data
Similar Domain Names
Server Information
Compare it to ...Kathrynleesmithwhitelineprints.com is hosted by MonsterCommerce, LLC.
IP Whois Get more Kathrynleesmithwhitelineprints.com server history
-
MonsterCommerce, LLC
-
206.188.192.57
IP address
Server Technologies
No data
DNS Records
Nameservers
- ns19.worldnic.com
- ns20.worldnic.com
host | value | ttl |
---|---|---|
kathrynleesmithwhitelineprints.com | 206.188.192.57 |
300 |
host | value | ttl | pri |
---|---|---|---|
kathrynleesmithwhitelineprints.com | mx004.netsol.xion.oxcs.net |
7200 | 10 |
kathrynleesmithwhitelineprints.com | mx003.netsol.xion.oxcs.net |
7200 | 10 |
kathrynleesmithwhitelineprints.com | mx001.netsol.xion.oxcs.net |
7200 | 10 |
kathrynleesmithwhitelineprints.com | mx002.netsol.xion.oxcs.net |
7200 | 10 |
host | value | ttl |
---|---|---|
kathrynleesmithwhitelineprints.com | ns20.worldnic.com |
7200 |
kathrynleesmithwhitelineprints.com | ns19.worldnic.com |
7200 |
host | value | ttl |
---|---|---|
kathrynleesmithwhitelineprints.com | Mname: NS19.WORLDNIC.com |
7200 |
host | value | ttl |
---|---|---|
kathrynleesmithwhitelineprints.com | Txt: google-site-verification=dUNxXy2cN-oMmf6cYtMwYy_t18grxDvNBu-p5Js2yuo |
7200 |
kathrynleesmithwhitelineprints.com | Txt: v=spf1 include:spf.registeredsite.com include:spf.cloudus.oxcs.net ~all |
7200 |
Safety
Compare it to ...Safety status of Kathrynleesmithwhitelineprints.com is described as follows: Google Safe Browsing reports its status as safe.
MyWOT
Overall reputation | Unknown |
---|---|
Trustworthiness | Unknown |
Privacy | Unknown |
Child safety | Unknown |
Google Safe Browsing
Website status | Safe |
---|---|
Status | ok |
User reviews
Reputation | Unknown | |
---|---|---|
0 positive0 negative |
Social Engagement
Compare it to ...It seems Kathrynleesmithwhitelineprints.com has no mentions in social networks.