Homekitchenappliances.madefreshly.com
Visit homekitchenappliances.madefreshly.comGlobal rank | - |
---|---|
Daily visitors | - |
Daily pageviews | - |
Pageviews per user | 0 |
Rating | |
---|---|
Status | Online |
Latest check |
Countable Data Brief
Madefreshly.com is tracked by us since May, 2012. Over the time it has been ranked as high as 115 799 in the world, while most of its traffic comes from USA, where it reached as high as 126 918 position. Homekitchenappliances.madefreshly.com receives less than 1% of its total traffic. It was owned by several entities, from trin salaloy of creative81 to REDACTED FOR PRIVACY of Privacy service provided by Withheld for Privacy ehf, it was hosted by Digital Ocean Inc., Amazon Technologies Inc. and others. While GODADDY.COM LLC was its first registrar, now it is moved to NameCheap Inc..
Homekitchenappliances.madefreshly has the lowest Google pagerank and bad results in terms of Yandex topical citation index. We found that Homekitchenappliances.madefreshly.com is poorly ‘socialized’ in respect to any social network. According to Google safe browsing analytics, Homekitchenappliances.madefreshly.com is quite a safe domain with no visitor reviews.
Worldwide Audience
Compare it to ...Madefreshly.com gets 48.1% of its traffic from USA where it is ranked #543216.
Top Countries
USA | 48.1% | |
India | 16.8% |
Top Ranks
India | 358 830 | |
USA | 543 216 |
Traffic Analysis
Compare it to ...It seems that the number of visitors and pageviews on this site is too low to be displayed, sorry.
Subdomains Traffic Shares
Homekitchenappliances.madefreshly.com has no subdomains with considerable traffic.
SEO Stats
Compare it to ...Homekitchenappliances.madefreshly.com is not yet effective in its SEO tactics: it has Google PR 0. It may also be penalized or lacking valuable inbound links.
0
Google PR-
Yandex CYHomepage Top Backlinks PR
No data
Top Keywords % of search traffic
No data
Domain Registration Data
Compare it to ...Homekitchenappliances.madefreshly.com domain is owned by Redacted for Privacy Privacy service provided by Withheld for Privacy ehf and its registration expires in 7 months.
General Get more Madefreshly.com whois history
Redacted for Privacy Privacy service provided by Withheld for Privacy ehf Owner since April 01, 2022 |
||
---|---|---|
7 months ago Expired on November 18, 2023 |
14 years old Created on November 18, 2009 |
1 year ago Changed at November 01, 2022 |
Server Information
Compare it to ...Homekitchenappliances.madefreshly.com is hosted by Amazon Technologies Inc.
IP Whois Get more Homekitchenappliances.madefreshly.com server history
-
Amazon Technologies Inc.
-
13.248.169.48
IP address
Server Technologies
No data
DNS Records
Nameservers
- ns1.namefind.com
- ns2.namefind.com
host | value | ttl |
---|---|---|
homekitchenappliances.madefreshly.com | 13.248.169.48 |
300 |
homekitchenappliances.madefreshly.com | 76.223.54.146 |
300 |
host | value | ttl |
---|---|---|
homekitchenappliances.madefreshly.com | ns2.namefind.com |
300 |
homekitchenappliances.madefreshly.com | ns1.namefind.com |
300 |
host | value | ttl |
---|---|---|
homekitchenappliances.madefreshly.com | Mname: ns1.namefind.com |
300 |
host | value | ttl |
---|---|---|
homekitchenappliances.madefreshly.com | Txt: v=spf1 -all |
300 |
Safety
Compare it to ...Safety status of Homekitchenappliances.madefreshly.com is described as follows: Google Safe Browsing reports its status as safe.
MyWOT
Overall reputation | Unknown |
---|---|
Trustworthiness | Unknown |
Privacy | Unknown |
Child safety | Unknown |
Google Safe Browsing
Website status | Safe |
---|---|
Status | ok |
User reviews
Reputation | Unknown | |
---|---|---|
0 positive0 negative |
Social Engagement
Compare it to ...It seems Homekitchenappliances.madefreshly.com has no mentions in social networks.