Evdeneveankaranakliyatfirmasi.com is tracked by us since December, 2011. Over the time it has been ranked as high as 5 512 799 in the world, while most of its traffic comes from Turkey, where it reached as high as 110 514 position. It was owned by several entities, from Moniker Privacy Services evdeneveankaranakliyatfirmasi.com@monikerprivacy.net to Domain Admin of Privacy Protect LLC (PrivacyProtect.org), it was hosted by Global Iletisim Hizmetleri A.S, BuyukHosting Internet ve Bili?im Hizmetleri and others. While was its first registrar, now it is moved to Aerotek Bilisim Sanayi ve Ticaret AS.

Evdeneveankaranakliyatfirmasi has a mediocre Google pagerank and bad results in terms of Yandex topical citation index. We found that Evdeneveankaranakliyatfirmasi.com is poorly ‘socialized’ in respect to any social network. According to Google safe browsing analytics, Evdeneveankaranakliyatfirmasi.com is quite a safe domain with no visitor reviews.