{{text}}
| Global rank | - |
|---|---|
| Daily visitors | - |
| Daily pageviews | - |
| Pageviews per user | 0 |
| Rating | |
|---|---|
| Latest check |
Amarprakashdevelopers.com is tracked by us since February, 2013. Over the time it has been ranked as high as 221 999 in the world, while most of its traffic comes from India, where it reached as high as 28 525 position. Trcchennairealty.amarprakashdevelopers.com receives less than 1% of its total traffic. It was hosted by DFL-NET, Host Europe GmbH and others. While GODADDY.COM LLC was its first registrar, now it is moved to GoDaddy.com LLC.
Trcchennairealty.amarprakashdevelopers has the lowest Google pagerank and bad results in terms of Yandex topical citation index. We found that Trcchennairealty.amarprakashdevelopers.com is poorly ‘socialized’ in respect to any social network. According to Google safe browsing analytics, Trcchennairealty.amarprakashdevelopers.com is quite a safe domain with no visitor reviews.
Amarprakashdevelopers.com gets 100% of its traffic from India where it is ranked #132549.
Top Countries
|
|
100.0% |
Top Ranks
|
|
132 549 |
It seems that the number of visitors and pageviews on this site is too low to be displayed, sorry.
Trcchennairealty.amarprakashdevelopers.com has no subdomains with considerable traffic.
Trcchennairealty.amarprakashdevelopers.com is not yet effective in its SEO tactics: it has Google PR 0. It may also be penalized or lacking valuable inbound links.
Ranks
0
Google PR
-
Yandex CY
| Homepage Top Backlinks | PR |
|---|---|
| No data |
Metadata Updates
Get more Trcchennairealty.amarprakashdevelopers.com metadata updates
{{text}}
| Top Keywords | % of search traffic |
|---|---|
| No data |
Trcchennairealty.amarprakashdevelopers.com domain is owned by Registration Private Domains By Proxy, LLC and its registration expires in 1 month.
General
Get more Trcchennairealty.amarprakashdevelopers.com whois history
Registration Private Domains By Proxy, LLC
Owner since December 02, 2023
1 month ago
Expires on September 14, 2024
13 years old
Created on September 14, 2011
2 years ago
Changed at June 11, 2022
In Other TLDs
No data
It seems Trcchennairealty.amarprakashdevelopers.com has no mentions in social networks.
Trcchennairealty.amarprakashdevelopers.com is hosted by Host Europe GmbH.
IP Whois
Get more Trcchennairealty.amarprakashdevelopers.com server history
Host Europe GmbH
87.247.245.131
IP address
Server technologies
No data
DNS Records
Host
trcchennairealty.amarprakashdevelopers.com
Value
87.247.245.131
ttl
300
Nameservers
No data
Safety status of Trcchennairealty.amarprakashdevelopers.com is described as follows: Google Safe Browsing reports its status as safe.
MyWOT
| Overall reputation | Unknown |
|---|---|
| Trustworthiness | Unknown |
| Privacy | Unknown |
| Child safety | Unknown |
Google Safe Browsing
| Website status | Safe |
|---|---|
| Status | ok |
User reviews
| Reputation | Unknown |
|---|
0
Positive0
NegativeRecently analyzed sites