easycounter

Tanganyikawildernesscamps.resrequest.com

Visit tanganyikawildernesscamps.resrequest.com

Global rank

-

Daily visitors -
Daily pageviews -
Pageviews per user 0
Rating
Latest check

Countable Data Brief

Resrequest.com is tracked by us since April, 2011. Over the time it has been ranked as high as 89 799 in the world, while most of its traffic comes from USA, where it reached as high as 136 244 position. Tanganyikawildernesscamps.resrequest.com receives less than 1% of its total traffic. It was owned by several entities, from Workflow Solutions (Pty) Ltd House 22 to REDACTED FOR PRIVACY of Privacy service provided by Withheld for Privacy ehf, it was hosted by C0201199905 and xneelo-tscolo. While TIERRANET INC. D/B/A DOMAINDISCOVER was its first registrar, now it is moved to NameCheap Inc..

Tanganyikawildernesscamps.resrequest has the lowest Google pagerank and bad results in terms of Yandex topical citation index. We found that Tanganyikawildernesscamps.resrequest.com is poorly ‘socialized’ in respect to any social network. According to Google safe browsing analytics, Tanganyikawildernesscamps.resrequest.com is quite a safe domain with no visitor reviews.

Worldwide Audience

Resrequest.com gets 20.7% of its traffic from USA where it is ranked #542175.

Top Countries

USA 20.7%

Top Ranks

USA 542 175

Traffic Analysis

It seems that the number of visitors and pageviews on this site is too low to be displayed, sorry.

Subdomains Traffic Shares

Tanganyikawildernesscamps.resrequest.com has no subdomains with considerable traffic.

SEO Stats

Tanganyikawildernesscamps.resrequest.com is not yet effective in its SEO tactics: it has Google PR 0. It may also be penalized or lacking valuable inbound links.

Ranks

0

Google PR

-

Yandex CY

Homepage Top Backlinks PR
No data
Top Keywords

% of search traffic

No data

Domain Registration Data

Tanganyikawildernesscamps.resrequest.com domain is owned by Redacted for Privacy Privacy service provided by Withheld for Privacy ehf and its registration expires in 1 month.

  • Redacted for Privacy Privacy service provided by Withheld for Privacy ehf

    Owner since December 03, 2021

  • 1 month left

    Expires on January 07, 2025

  • 21 years old

    Created on January 07, 2003

  • 11 months ago

    Changed at December 08, 2023

In Other TLDs

No data

Social Engagement

It seems Tanganyikawildernesscamps.resrequest.com has no mentions in social networks.

Server Information

Tanganyikawildernesscamps.resrequest.com is hosted by xneelo-tscolo.

xneelo-tscolo

129.232.235.234

IP address

Server technologies

  • Nginx

    Backend server

DNS Records

  • Host

    tanganyikawildernesscamps.resrequest.com

    Value

    129.232.235.234

    ttl

    289

Nameservers

No data

Safety

Safety status of Tanganyikawildernesscamps.resrequest.com is described as follows: Google Safe Browsing reports its status as safe.

MyWOT

Overall reputation Unknown
Trustworthiness Unknown
Privacy Unknown
Child safety Unknown

Google Safe Browsing

Website status Safe
Status ok

User reviews

Reputation Unknown

0

Positive

0

Negative

Recently analyzed sites