| Global rank | 419 699 |
|---|---|
| Daily visitors | - |
| Daily pageviews | - |
| Pageviews per user | 0 |
| Rating | |
|---|---|
| Latest check |
Msreklam.com.tr is tracked by us since November, 2018. Over the time it has been ranked as high as 445 199 in the world, while most of its traffic comes from Turkey, where it reached as high as 11 247 position. Sc.msreklam.com.tr receives less than 19.35% of its total traffic. It was owned by several entities, from Ahmet Tutak to Hidden upon user request of Çizgi Telekomünikasyon A.Ş., it was hosted by Veridyen Bilisim Teknolojileri Sanayi ve Ticaret Limited Sirketi and Yunus Emre Atilgan trading as Poyraz Hosting.
Sc.msreklam has the lowest Google pagerank and bad results in terms of Yandex topical citation index. We found that Sc.msreklam.com.tr is poorly ‘socialized’ in respect to any social network. According to Google safe browsing analytics, Sc.msreklam.com.tr is quite a safe domain with no visitor reviews.
Msreklam.com.tr gets 100% of its traffic from Turkey where it is ranked #34595.
Top Countries
|
|
100.0% |
Top Ranks
|
|
34 595 |
It seems that the number of visitors and pageviews on this site is too low to be displayed, sorry.
Blog.msreklam.com.tr is the most popular subdomain of Msreklam.com.tr with 19.35% of its total traffic.
Top Subdomains
100.00%
19.35%
This Subdomain
Sc.msreklam.com.tr is not yet effective in its SEO tactics: it has Google PR 0. It may also be penalized or lacking valuable inbound links.
Ranks
0
Google PR
-
Yandex CY
| Homepage Top Backlinks | PR |
|---|---|
| adanaevdenevenakliyatfirmalari.com | 0 |
| Top Keywords | % of search traffic |
|---|---|
| No data |
Sc.msreklam.com.tr domain is owned by Hidden upon user request Çizgi Telekomünikasyon A.Ş. and its registration expires in 2 months.
General
Get more Sc.msreklam.com.tr whois history
Hidden upon user request Çizgi Telekomünikasyon A.Ş.
Owner since April 27, 2023
2 months left
Expires on September 12, 2024
5 years old
Created on September 13, 2018
54 years ago
Changed at January 01, 1970
In Other TLDs
No data
It seems Sc.msreklam.com.tr has no mentions in social networks.
Sc.msreklam.com.tr is hosted by Yunus Emre Atilgan trading as Poyraz Hosting.
IP Whois
Get more Sc.msreklam.com.tr server history
Yunus Emre Atilgan trading as Poyraz Hosting
185.223.77.141
IP address
Server technologies
Nginx
Backend server
DNS Records
Host
sc.msreklam.com.tr
Value
185.223.77.141
ttl
300
Nameservers
No data
Safety status of Sc.msreklam.com.tr is described as follows: Google Safe Browsing reports its status as safe.
MyWOT
| Overall reputation | Unknown |
|---|---|
| Trustworthiness | Unknown |
| Privacy | Unknown |
| Child safety | Unknown |
Google Safe Browsing
| Website status | Safe |
|---|---|
| Status | ok |
User reviews
| Reputation | Unknown |
|---|
0
Positive0
NegativeRecently analyzed sites